Protein Info for Pf6N2E2_654 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphate-binding DING protein (related to PstS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF12849: PBP_like_2" amino acids 51 to 277 (227 residues), 88.8 bits, see alignment E=2.6e-29

Best Hits

Swiss-Prot: 73% identical to PPBL_PSEAB: Alkaline phosphatase L (phoA2) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a3225)

Predicted SEED Role

"Phosphate-binding DING protein (related to PstS)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVK2 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Pf6N2E2_654 Phosphate-binding DING protein (related to PstS) (Pseudomonas fluorescens FW300-N2E2)
MFKRNVLAVSLTLAGLCAAQAAMADVNGGGATLPQPLYQTSGVLTAGFAPYIGVGSGAGK
AAFLTNDYTKFVPGDTSGKKVHWAGSDSKLSATELSTYVSAHGAAWGPLIQVPSVATSVA
IPFNKTGTANVDLSVNQLCGVFSGRLTDWSQITGSGRTGAITVVYRSESSGTTELFTRFL
NAKCAETGTFSVTTTFASSYSGGLPAGAVSASGSANVMTALNAAQGRITYMSPDYAATTL
AGLDDATKVARVGGLSPAPANVSAAINAVTVPAVADRSKPNAWVPIFTSQKVIDETIPAD
PSLRLYPTTGYPILGFTNVIFSQCYADATQTTQVRNFFSRHYGSLTNNDSAITANRFVPL
PSAWKTAIRDSFVTASNGLSIGNTSVCNAIGRPL