Protein Info for Pf6N2E2_651 in Pseudomonas fluorescens FW300-N2E2

Annotation: General secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 101 to 724 (624 residues), 677.5 bits, see alignment E=8.8e-208 PF21305: type_II_gspD_N0" amino acids 101 to 170 (70 residues), 81.5 bits, see alignment E=4.8e-27 PF03958: Secretin_N" amino acids 196 to 256 (61 residues), 51.4 bits, see alignment 1.6e-17 amino acids 259 to 326 (68 residues), 47.5 bits, see alignment E=2.5e-16 amino acids 333 to 465 (133 residues), 46.3 bits, see alignment E=6.2e-16 PF00263: Secretin" amino acids 549 to 715 (167 residues), 163.9 bits, see alignment E=4e-52

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 97% identity to pba:PSEBR_a3228)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZS25 at UniProt or InterPro

Protein Sequence (787 amino acids)

>Pf6N2E2_651 General secretion pathway protein D (Pseudomonas fluorescens FW300-N2E2)
MKGARYPRHWRKAAPLLLLALSACNSTPPASQPPLLVDSELGIPLGSTQRSGDAVLDRQR
AQDLREHKPAVRHQVDLTTRAREPRSNAPARTPLGDQPVTLNFVEADIQAVVRALSRSTG
QQFLVDPRVKGNLTLVSEGQVPAHQAYDMLLAALRMQGFSVVDVGGVAQVVPEADAKLLG
GPIYSADKPAGNGMLTRTFRLQYENAVNLIPVLRPIVSPNNPINAYPGNNTIVVTDYAEN
LSRVAQLIEGIDTPSAIDTDVVPIHNGIAVDIAQMVSDLLETQGGDQTQKINVIGDPRSN
SIIIRAGSPERTELARNLIYKLDNAQNNPSNLHVVYLRNAQAGKLAQALRGLLTGESEGE
SSDNSRSVLSGMGASTNGQSGQGSSGDGTSGTTSGNASTSGNGYGQGSNGTTPASTKNEQ
NTAFSAGGVTIQADATTNTLLISAPDPLYRNLREVIDLLDQRRAQVVIESLIVEVGEDDA
SEFGVQWQTGNLGGSGVIGGVNLGGTALNLNGKTSIDVLPQGLNLGVVNGTVDIPGIGKI
LDLKVLARALKSKGGTNVLSTPNLLTLDNEAASIFVGQTIPFVSGSYVTGGGGTSNNPFQ
TVTREEVGLKLNVRPQISEGGTVKLDIYQEVSSVDNRASSTTGIVTNKRAIDTSILLDDG
QIMVLGGLLQDGYSQSNDAVPWLSTIPGIGALFRNERRQITKTNLMVFLRPYIIRDTAAG
RGITLNRYDFMRRAQGLLQPDRSWAMPDMQAPQLPASARAIPGTAPAGVQMPRAVIKAVP
VMEPIGQ