Protein Info for Pf6N2E2_628 in Pseudomonas fluorescens FW300-N2E2

Annotation: 2-ketogluconate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 375 (358 residues), 195.9 bits, see alignment E=4.6e-62

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3250)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZS07 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Pf6N2E2_628 2-ketogluconate transporter (Pseudomonas fluorescens FW300-N2E2)
MQTLNLATRRWWYIMPIVFITYSLAYLDRANYGFAAASGMAKDLMITPGLSSLLGALFFL
GYFFFQVPGAIYAQKHSVKKLIFVSLILWGSLATLTGVVSNAYWLIVIRFMLGVVEAAVM
PAMLVYLCHWFTRAERSRANTFLILGNPVTMLWMSVVSGYLVQQFDWRWMFIIEGLPAVL
WAFIWWRLADDRPSQAKWLSDQEKHDLESALAAEQVGIKAVKNYAEAFRSPKVIILALQF
FCWSIGVYGFVLWLPSILKAGLQMNMVEAGWLSSLPYLAAVIGMLVVSWASDKAQKRKRF
VWPPLLVASIAFYASYLLGPEHFWWSYSLLVVAGACMYAPYGPFFAIVPEILPANVAGGA
MALINSMGALGSFGGSYLVGYLNGSTGSPGMSFLLMSGALLVAVVLTLALKPGASDRVLS
KTATPHSAPAHS