Protein Info for Pf6N2E2_622 in Pseudomonas fluorescens FW300-N2E2

Annotation: BatA (Bacteroides aerotolerance operon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 59 to 77 (19 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details PF00092: VWA" amino acids 91 to 278 (188 residues), 73.8 bits, see alignment E=4.2e-24 PF01882: DUF58" amino acids 91 to 202 (112 residues), 25.5 bits, see alignment E=1.5e-09 PF13519: VWA_2" amino acids 93 to 203 (111 residues), 60.7 bits, see alignment E=3.8e-20

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 98% identity to pba:PSEBR_a3255)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVI2 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Pf6N2E2_622 BatA (Bacteroides aerotolerance operon) (Pseudomonas fluorescens FW300-N2E2)
MFEFAWPWVFALLPLPWLMRLVLPAADSGEPALKVSFLGDLEGLVGRRARANLPTWRQQA
PFILLWLLLLIAAARPQWLGEPLPIAASGRDLLVAVDVSGSMDFPDMQWKDEEVSRLVLV
QHMLGDFLEGREGDRVGLILFGSQAYLQAPLTFDRRTVRHWLDEARIGIAGKNTAIGDAI
GLALKRLRQRPAHSRVLILVTDGANNGGEIDPLTAARLAADEGVKIYPIGIGADPEQSGT
TGLLGVNPSLDLDEPTLKEIAQATGGQYFRAQDGAQLLAIKTTLDQLEPVTQQPTQARPA
LALYHWPLAVALLLSMLLVARARWPDNPLQRLFNQPLFQPAQHTEWRQRLKRLRLRRRR