Protein Info for Pf6N2E2_6060 in Pseudomonas fluorescens FW300-N2E2

Annotation: Propionate catabolism operon transcriptional regulator of GntR family [predicted]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00392: GntR" amino acids 18 to 80 (63 residues), 58.9 bits, see alignment E=3.1e-20 PF07729: FCD" amino acids 90 to 216 (127 residues), 107.7 bits, see alignment E=5.5e-35

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3959)

Predicted SEED Role

"Propionate catabolism operon transcriptional regulator of GntR family [predicted]" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4K2 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Pf6N2E2_6060 Propionate catabolism operon transcriptional regulator of GntR family [predicted] (Pseudomonas fluorescens FW300-N2E2)
MLDQLETPVVAQDDSETLSENVFRRIQAAIVKGEIAPGSKISEPELARTYGISRGPLREA
IHRLEGQRLLVRVPHVGARVVSLSHAELLELYEIRESLEGMACRLAAERMTLEEIDELRR
VLETHERDAAFQAGVGYYQQEGDFDFHYRIIQGSGNRTLTQMLCGELYQLVRMYRIQFST
TPNRPRQAFAEHHRILDAIADRDGELAELLMRRHIGASKRNIARHFQDSATERGES