Protein Info for Pf6N2E2_5950 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphate:acyl-ACP acyltransferase PlsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 9 to 287 (279 residues), 292.5 bits, see alignment E=2.1e-91 PF02504: FA_synthesis" amino acids 10 to 278 (269 residues), 287.1 bits, see alignment E=1.7e-89 PF01515: PTA_PTB" amino acids 40 to 158 (119 residues), 24.4 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 92% identical to PLSX_PSEPF: Phosphate acyltransferase (plsX) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 98% identity to pba:PSEBR_a4053)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GM86 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Pf6N2E2_5950 Phosphate:acyl-ACP acyltransferase PlsX (Pseudomonas fluorescens FW300-N2E2)
MLSGQSAVDRARLTIAPASEIITMDEKPAQVLRGKPDASMRVALELLRDGRVQACVSAGN
TGALMALSRYVLKTLPGIDRPAMVAAIPTQRGFCQLLDLGANVDCSAEHLLQFAVMGSVA
AQTLGIVRPRVALLNIGTEDIKGNQQVKLAATLLQGARGINYIGFIEGDGLYRGEADVVV
CDGFVGNILLKSSEGLATMIGQRIEALFKQSFASRVVGALALPLMRRLQADLAPARHNGA
SFLGLQGIVIKSHGSAGVQGFQSAINRAVIEIQENLPERLHGRLEDLLT