Protein Info for Pf6N2E2_5933 in Pseudomonas fluorescens FW300-N2E2

Annotation: Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 19 to 326 (308 residues), 353.3 bits, E=6.4e-110
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 26 to 313 (288 residues), 249.8 bits, E=1.8e-78

Best Hits

Swiss-Prot: 85% identical to LPXK_PSEPF: Tetraacyldisaccharide 4'-kinase (lpxK) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 97% identity to pba:PSEBR_a4068)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (18/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See A0A161H9L4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Pf6N2E2_5933 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Pseudomonas fluorescens FW300-N2E2)
MAMSDRLLAAWYEGHPALALLRPLEWMYRRVVVGKRERFLAGEGQIYQPPVPLVVVGNIT
VGGTGKTPLILWLIQHCQRSGLRVGVVSRGYGAKPPQLPWRVAAEQGADIAGDEPLLIVQ
RTGVPLMIDPDRSRAIQALLEAEPLDLILSDDGMQHYRMARDLELVLIDNARGLGNRRCL
PAGPLREPVERLQSVDAVLYNGASADREDGFAFQLRPTELVNLASGERRPLDHFPPGQAL
HAVAGIGNPQRFFKTLETLHWRPIPHGFADHAEYSAQALSFKPSLPVVMTEKDAVKCRAF
AAPDWWYLAVDAAPSPAFAAWFDTQLIRLLPDRLLP