Protein Info for Pf6N2E2_5928 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 14 to 223 (210 residues), 139.3 bits, see alignment E=1.3e-44 PF12698: ABC2_membrane_3" amino acids 63 to 247 (185 residues), 46.4 bits, see alignment E=3.2e-16

Best Hits

Swiss-Prot: 60% identical to YADH_ECO57: Inner membrane transport permease YadH (yadH) from Escherichia coli O157:H7

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 99% identity to pba:PSEBR_a4073)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X6Y9 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Pf6N2E2_5928 ABC-type multidrug transport system, permease component (Pseudomonas fluorescens FW300-N2E2)
MSMSSELRPNLIALNTIVYREVRRFMRIWPQTLLPPAITMVLYFVIFGNLIGRQIGDMGG
FTYMDYIVPGLIMMSVITNSYGNVVSSFFGSKFQRSIEELMVSPVSPHTILIGYTLGGVL
RGLAVGLIVTLLSLFFTDLQVHHLGVTVLVVVLTATIFSLLGFINAVFARNFDDISIIPT
FVLTPLTYLGGVFYSISLLPPFWQTVSLANPVLHMVNAFRYGILGVSDIKISIAITFMLV
ATVVLYIGCARLLVSGRGMRT