Protein Info for Pf6N2E2_5888 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative NADP-dependent oxidoreductase PA1648

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF16884: ADH_N_2" amino acids 7 to 114 (108 residues), 128.4 bits, see alignment E=1.6e-41 PF00107: ADH_zinc_N" amino acids 159 to 289 (131 residues), 72.4 bits, see alignment E=5.1e-24 PF13602: ADH_zinc_N_2" amino acids 192 to 332 (141 residues), 50.2 bits, see alignment E=7.6e-17

Best Hits

KEGG orthology group: K07119, (no description) (inferred from 100% identity to pba:PSEBR_a4107)

Predicted SEED Role

"Putative NADP-dependent oxidoreductase PA1648"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H505 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Pf6N2E2_5888 Putative NADP-dependent oxidoreductase PA1648 (Pseudomonas fluorescens FW300-N2E2)
MTAQTNRQFLLAKRPVGAATRETFTYQQVPVGEPAAGQILVKNEYLSLDPAMRGWMNEGK
SYIPPVGIGEVMRALGVGQVIASNNPGFAVGDYVNGALGVQDYFLGEPRGFYKVDPKLAP
LPRYLSALGMTGMTAYFALLDVGAPKAGETVVLSGAAGAVGSIAGQIAKIKGCRVVGIAG
GADKCKFLVDELGFDGAIDYKNEDVHAGLKRECPKGVDVYFDNVGGDILDAVLSRLNLKA
RVVICGAISQYNNKDAVKGPANYLSLLVNRARMEGFVVMDYAAQFAAAGQEMAGWMAKGQ
LKSKEDIVEGLETFPETLTKLFSGENFGKLVLKV