Protein Info for Pf6N2E2_5886 in Pseudomonas fluorescens FW300-N2E2

Annotation: DNA-binding response regulator GltR, controls specific porins for the entry of glucose

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00072: Response_reg" amino acids 26 to 134 (109 residues), 93.8 bits, see alignment E=7.6e-31 PF00486: Trans_reg_C" amino acids 173 to 246 (74 residues), 85.8 bits, see alignment E=1.7e-28

Best Hits

Swiss-Prot: 50% identical to VIRG_RHIRD: Regulatory protein VirG (virG) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4109)

Predicted SEED Role

"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZRU2 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Pf6N2E2_5886 DNA-binding response regulator GltR, controls specific porins for the entry of glucose (Pseudomonas fluorescens FW300-N2E2)
MQNTPVANSDDQKVSDDDKRWSTRALIVDDDVPIRELLIDYLARFSIRASGVTDGAAMRQ
AMQAEHFDVIVLDLMLPGEDGLQLCRWLRAESDIPILMLTARCEPTDRIIGLELGADDYM
AKPFEPRELVARIQTILRRVRDDRSEHRANIRFDNWRLNSVLRQLISANGLVVPLSNAEF
RLLWVFIERPRRVLSREQLLDAARGRSIEAFDRSIDLLVSRLRQKLGDDPKAPQLIKTVR
GEGYLFDARDIG