Protein Info for Pf6N2E2_5883 in Pseudomonas fluorescens FW300-N2E2

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF13202: EF-hand_5" amino acids 30 to 50 (21 residues), 15.8 bits, see alignment (E = 1.9e-06) amino acids 105 to 126 (22 residues), 20.3 bits, see alignment (E = 7.5e-08) amino acids 139 to 158 (20 residues), 20.9 bits, see alignment (E = 4.9e-08) PF13833: EF-hand_8" amino acids 100 to 125 (26 residues), 17.4 bits, see alignment (E = 7.6e-07) PF13499: EF-hand_7" amino acids 106 to 158 (53 residues), 31.9 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 51% identity to psp:PSPPH_2002)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GU45 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Pf6N2E2_5883 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8) (Pseudomonas fluorescens FW300-N2E2)
MIGSVSSYSTYTSTSSTATSSARSQQFQKELLSKLDSDGDGSVNQEELSTALSQKNDDGI
LVSLSDNFGDLDSDGSGDLSSEEMAAMAPPPPPPRSQAPNTELADALLSVLDTDGDGSVS
SDELSNGLASTDSDADSQQVFSALDKNEDGTVSLDELAASLAPPPPPQQGSGEELFSQLD
ADGDATASELSSALQAGRRSDSSTEQANVSEALNRMIANLSRQYSLDNVATVGKHLNVAT