Protein Info for Pf6N2E2_5844 in Pseudomonas fluorescens FW300-N2E2

Annotation: Membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 75 to 100 (26 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 270 to 296 (27 residues), see Phobius details PF05661: DUF808" amino acids 4 to 289 (286 residues), 379.9 bits, see alignment E=4e-118

Best Hits

Swiss-Prot: 65% identical to YEDI_ECOLI: Inner membrane protein YedI (yedI) from Escherichia coli (strain K12)

KEGG orthology group: K09781, hypothetical protein (inferred from 97% identity to pba:PSEBR_a4151)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4Y2 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Pf6N2E2_5844 Membrane protein, putative (Pseudomonas fluorescens FW300-N2E2)
MAGSSLLVLIDDIATVLDDVALMTKMAAKKTAGVLGDDLALNAQQVSGVRAERELPVVWA
VAKGSFINKLILVPSALAISAFVPWLVTPLLMVGGAYLCFEGFEKLAHKFLHSPAEEQAE
HAQLVEAVADPAVDLVAFEKDKIKGAVRTDFILSAEIIAITLGTVADAALTQQVIVLSGI
AIVMTIGVYGLVAGIVKLDDLGLWLTQKPGQAAKSIGGAILSAAPYMMKSLSVIGTAAMF
LVGGGILTHGVPVVHHWIEGVTASAGGAGFIVPMLLNAVAGIVAGAAVLAGVMVVGKVWK
ALKG