Protein Info for Pf6N2E2_5819 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 6 to 287 (282 residues), 425.5 bits, see alignment E=1.5e-131 TIGR00536: methyltransferase, HemK family" amino acids 8 to 286 (279 residues), 274.9 bits, see alignment E=9.8e-86 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 57 to 261 (205 residues), 199.6 bits, see alignment E=9.4e-63 PF06325: PrmA" amino acids 124 to 200 (77 residues), 26.6 bits, see alignment E=1.9e-09 PF03602: Cons_hypoth95" amino acids 125 to 207 (83 residues), 26.5 bits, see alignment E=2.1e-09 PF10294: Methyltransf_16" amino acids 125 to 179 (55 residues), 25.4 bits, see alignment E=5e-09 PF13847: Methyltransf_31" amino acids 127 to 252 (126 residues), 43.6 bits, see alignment E=1.2e-14 PF05175: MTS" amino acids 127 to 208 (82 residues), 60 bits, see alignment E=1e-19 PF09445: Methyltransf_15" amino acids 128 to 198 (71 residues), 24.9 bits, see alignment E=6.1e-09 PF13649: Methyltransf_25" amino acids 129 to 211 (83 residues), 37.8 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 82% identical to PRMB_PSEAE: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 100% identity to pba:PSEBR_a4174)

MetaCyc: 55% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H9F2 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Pf6N2E2_5819 Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p (Pseudomonas fluorescens FW300-N2E2)
VITSRLRTLRDHIRWAVSRFHGEDLFFGHGTDNAWDEARQLVLGALHLPWEIADSYLDCR
LEDEELVHVQRLLRRRITERVPTAYLLGEAWFCGMSFIVDERVLIPRSPIGELIEKHFEP
WLGQEPARILDLCTGSGCIGIACAYEFPEAEVVLADLSFEALEVANQNIERHGVDERVFT
VQGDGFDGLPGQRFDLIVSNPPYVDAEDFADMPQEYQHEPELGLACGDDGLNLVRRMLAE
AADHLTEKGLLIVEVGNSQVHVEALYPEVDFAWLDFERGGHGVFMLSAEQCRQHQGLFAS
RV