Protein Info for Pf6N2E2_5802 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ureidoglycolate hydrolase (EC 3.5.3.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 94% identical to ALLA_PSEFS: Ureidoglycolate lyase (allA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 98% identity to pba:PSEBR_a4187)

MetaCyc: 51% identical to ureidoglycolate lyase (Escherichia coli K-12 substr. MG1655)
Ureidoglycolate lyase. [EC: 4.3.2.3]

Predicted SEED Role

"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)

MetaCyc Pathways

superpathway of purines degradation in plants (14/18 steps found)
superpathway of allantoin degradation in yeast (5/6 steps found)
allantoin degradation to glyoxylate I (2/3 steps found)
superpathway of allantoin degradation in plants (4/8 steps found)
allantoin degradation to glyoxylate II (1/5 steps found)
allantoin degradation to glyoxylate III (1/5 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.19 or 4.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZQS9 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Pf6N2E2_5802 Ureidoglycolate hydrolase (EC 3.5.3.19) (Pseudomonas fluorescens FW300-N2E2)
MRTLKIEPLTKEAFAPFGDVIETDGSDHFMINNGSTMRFHRLATVQTATPDDQAIISIFR
ADALEMPLTVRMLERHPLGSQAFIPLLGNPFLIVVAPLGDAPVSGLVRAFVTNGRQGINY
HRGVWHHPVLTIEKRDDFLVVDRSGTGNNCDEHFFQEDELLILAPHQ