Protein Info for Pf6N2E2_5801 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG137887: membrane protein related to purine degradation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF06181: Urate_ox_N" amino acids 1 to 289 (289 residues), 414.5 bits, see alignment E=1.3e-128

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a4188)

Predicted SEED Role

"FIG137887: membrane protein related to purine degradation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GU15 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Pf6N2E2_5801 FIG137887: membrane protein related to purine degradation (Pseudomonas fluorescens FW300-N2E2)
MLEWLNLSVRWVHMITGVAWIGASFYFVWLENNLNRVNPKSGLAGDLWAIHGGGIYHLEK
YKLAPPSMPENLHWFKWEAYFTWMSGVALLCVVFYWNPTLYLLAPGSSLSGPEGVALGIG
SLFVGWFVYSFLCDSALGKRPALLGLILFVLLIAAAYGFSKVFSGRGAYLHVGAVIGTIM
VGNVFRIIMPAQRALVAAIAENRTPDPALPAKGLLRSRHNNYFTLPVLFIMISNHFPSTY
GSQYNWLILAGIAVAAVLVRHYFNTRHDSNRFAWTLPVGALAMICLAYVTGPKPMPSAPD
VAKTPAAIEYQPLPETAVGGGAKPATAPAAPASASAPTQAAKAQGPSFEKVHSVIQERCS
VCHSAKPTSPLFSAAPGGVMFDTPEQIQQQAARIQAQAVATQIMPLGNITQMTQQERDLI
GAWINQGARTN