Protein Info for Pf6N2E2_5767 in Pseudomonas fluorescens FW300-N2E2
Annotation: Sodium-dependent transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to YOCS_BACSU: Uncharacterized sodium-dependent transporter YocS (yocS) from Bacillus subtilis (strain 168)
KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 96% identity to pfs:PFLU1876)Predicted SEED Role
"Sodium-dependent transporter"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A160A436 at UniProt or InterPro
Protein Sequence (321 amino acids)
>Pf6N2E2_5767 Sodium-dependent transporter (Pseudomonas fluorescens FW300-N2E2) MRALAALSRFVGNTFAYWVLFFAVVAFLQPVWFIGLKSAIVPLLGLVMFGMGLTLKLEDF AEVARHPWRVALGVVAHFVIMPGVAWLLCQVFHLPPEIAVGVILVGCCPSGTSSNVMTWL ARGDLALSVAIAAVTTLLAPLLTPALIWLLASAWLPVSFMELFWSILQVVLLPIVLGVVA QRLLGDKVRHAVEVLPLVSVVSIVIIVTAVVAASQAKIAESGLLIMAVVMLHNSFGFLLG YFTGHLFKLPLAQRKSLALEVGMQNSGLGAALASAHFSPLAAVPSALFSVWHNISGALLS TYFRRMSEKQDRELQARPAAD