Protein Info for Pf6N2E2_5699 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional regulatory protein RstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 92 bits, see alignment E=2.8e-30 PF00486: Trans_reg_C" amino acids 155 to 230 (76 residues), 85.9 bits, see alignment E=1.6e-28

Best Hits

Swiss-Prot: 39% identical to MPRA_MYCTU: Response regulator MprA (mprA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07661, two-component system, OmpR family, response regulator RstA (inferred from 99% identity to pba:PSEBR_a4282)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2E9 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Pf6N2E2_5699 Transcriptional regulatory protein RstA (Pseudomonas fluorescens FW300-N2E2)
MEQEAWQVLIVEDDQRLAELTREYLESNGLRVAIEGDGAVAAARIIAEQPDLVILDLMLP
GEDGLSICRKVRGHYDGPILMLTARTDDTDQIQGLDLGADDYVCKPVRPRLLLARIQALL
RRSEPEPSVAQKQRRLQFGPLVVDDALREAWLQGNGIELTSAEFDLLWLLVSNAGRILSR
EEIFTALRGIGYDGQDRSIDVRISRIRPKIGDDPDHPRLIKTIRSKGYLFVPEACVDPAP