Protein Info for Pf6N2E2_5578 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferric iron ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00005: ABC_tran" amino acids 22 to 164 (143 residues), 125.3 bits, see alignment E=4.3e-40 PF13304: AAA_21" amino acids 115 to 197 (83 residues), 28.5 bits, see alignment E=2.3e-10 PF08402: TOBE_2" amino acids 276 to 345 (70 residues), 46.4 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4401)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3Y2 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Pf6N2E2_5578 Ferric iron ABC transporter, ATP-binding protein (Pseudomonas fluorescens FW300-N2E2)
MSHSLLLNLHDLACGYQNQRVVQNLNLHLNAGDIGCLLGSSGCGKTTTLRAIAGFEPVHE
GEIQLAGETISRAGFTLAPEKRRIGMVFQDYALFPHLSVAENIAFGIRKHPDKDRVVEEL
LELVNLKNLGKRFPHELSGGQQQRVALARALAPEPQLLLLDEPFSNLDGELRRKLSHEVR
DILKARGTSAILVTHDQEEAFAVSDHVGVFKEGRLEQWDTPYNLYHEPLTPFVASFIGQG
YFIRGQLDSPESVQTELGTLRGNRAYTWPIGGAVDVLLRPDDIVYAPDSPLTASIVGKTF
LGASTLYRLQLPTGAQLESIFPSHADHQVGDRVGIRVAAEHLVLFQASGSTAAHIPPVES
GVRRYSTAS