Protein Info for Pf6N2E2_5568 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 116 (105 residues), 81.2 bits, see alignment E=3.3e-27 PF00528: BPD_transp_1" amino acids 33 to 221 (189 residues), 74.8 bits, see alignment E=3.9e-25

Best Hits

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 100% identity to pba:PSEBR_a4410)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A260 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Pf6N2E2_5568 Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4) (Pseudomonas fluorescens FW300-N2E2)
MEFDFTGIIPAIPGLWNGMVMTLKLMALGVVGGIILGTILALMRLSHNKLVSNIAGAYVN
YFRSIPLLLVITWFYLAVPFVLRWITGEDTPIGAFGSCIVAFMMFEAAYFCEIVRAGVQS
IPKGQMGAAQALGMNYGQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLN
ASRASGDIIGRSNEFLIIAGLVYFTVSFAASQLVKRLQKRFAV