Protein Info for Pf6N2E2_5542 in Pseudomonas fluorescens FW300-N2E2

Annotation: tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 12 to 422 (411 residues), 526.2 bits, see alignment E=3.1e-162 PF04052: TolB_N" amino acids 18 to 120 (103 residues), 100 bits, see alignment E=1.6e-32 PF07676: PD40" amino acids 188 to 221 (34 residues), 29.7 bits, see alignment 9.2e-11 amino acids 230 to 265 (36 residues), 51.4 bits, see alignment 1.5e-17 amino acids 274 to 309 (36 residues), 54.6 bits, see alignment 1.4e-18 amino acids 366 to 393 (28 residues), 13.1 bits, see alignment (E = 1.6e-05)

Best Hits

Swiss-Prot: 94% identical to TOLB_PSEF5: Tol-Pal system protein TolB (tolB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to pba:PSEBR_a4435)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3Q1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Pf6N2E2_5542 tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins (Pseudomonas fluorescens FW300-N2E2)
MLVVICCLAGIAVAEEKNILVTSGSDRATPIAVVPFGWQGGNVLPDDMAEIIGNDLRNSG
YYAPIPKQNMISLPTQASEVIYRDWKALGAQYIMVGSIVPAGGRLQVQYALFNVATEQQV
LTGSVSGSVDQLRDMAHYIADQSFEKLTGIKGAFSTRMLYVTAERFSENNTRYTLQRSDY
DGARAVTLLQSREPILSPRFAPDGKRIAYVSFEQKRPRIFVQHIDTGRREQITNFEGLNG
APAWSPDGSRLAFVLSKDGNPDIYVMNLASRSISRVTNGPGINTEPFWGKDGSTIYFTSD
RGGKPQIYKTSAGGGGAERVTFVGNYNANPKLSADEKTLVMIHRQDGFTNFKVAAQDLQR
GSVKILTDSTLDESPTVAPNGTMVIYATRQQGRGVLMLVSINGRVRLPLPTAQGEVREPS
WSPYLN