Protein Info for Pf6N2E2_5536 in Pseudomonas fluorescens FW300-N2E2

Annotation: Holliday junction DNA helicase RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 200 (200 residues), 200.5 bits, see alignment E=9.6e-64 PF01330: RuvA_N" amino acids 2 to 62 (61 residues), 81.2 bits, see alignment E=1.4e-26 PF14520: HHH_5" amino acids 72 to 130 (59 residues), 61.4 bits, see alignment E=2.8e-20 PF07499: RuvA_C" amino acids 158 to 201 (44 residues), 61.4 bits, see alignment 2.7e-20

Best Hits

Swiss-Prot: 94% identical to RUVA_PSEF5: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 99% identity to pba:PSEBR_a4441)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3V6 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Pf6N2E2_5536 Holliday junction DNA helicase RuvA (Pseudomonas fluorescens FW300-N2E2)
VIGRLRGTLAEKQPPHLILDVNGLGYELEVPMTTLYRLPSVGEPLTLHTHLVVREDAQLL
YGFVGKRERDFFRELIRLNGVGPKLALALMSSLEVDELVRCVQSQDTSALTKVPGVGKKT
AERLLVELKDRFKAWEAVPAMFALVPNQPDAPAPAVSAENDAVTALISLGYKPQEASKAI
SAIKEKGLSTEDMIRRALKGMI