Protein Info for Pf6N2E2_5534 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG000859: hypothetical protein YebC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 237 (237 residues), 334.7 bits, see alignment E=1.8e-104 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 110.9 bits, see alignment E=3.2e-36 PF01709: Transcrip_reg" amino acids 83 to 237 (155 residues), 212 bits, see alignment E=4.2e-67

Best Hits

Swiss-Prot: 97% identical to Y4410_PSEPF: Probable transcriptional regulatory protein Pfl01_4410 (Pfl01_4410) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a4443)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WK60 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Pf6N2E2_5534 FIG000859: hypothetical protein YebC (Pseudomonas fluorescens FW300-N2E2)
MAGHSKWANIKHRKERQDAKRGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN
MSRDIIDRAIARGAGATEADNVEELTYEGYGPGGVAVMVECMTDNRNRTAAAVRHAFSKC
GGNLGTDGSVAYLFERKGQISFAPGLDEDALTEAALEADADDVVSHEDGSFDVFTSFASF
YAVRNALEAAGFKPADAEIVMQPTTSAELDLEGAEKVLKLIDMLEDLDDVQNVYSNADIP
ESVAEQLG