Protein Info for Pf6N2E2_5503 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG01248689: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 103 to 125 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 219 to 249 (31 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details PF01944: SpoIIM" amino acids 119 to 289 (171 residues), 119 bits, see alignment E=9.8e-39

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4470)

Predicted SEED Role

"FIG01248689: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A213 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Pf6N2E2_5503 FIG01248689: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MKQSLFESRHQGEWEHLARQLDQLERSRSVPQSSDFPATYRRLCHHLALAQARGYSSLLV
DTLQQLALRGHQQLYRDRSRPSTGLSAFILAGFPRLVREQWRFVLAASLMFLGSLVGIGL
LVYLFPELVYSVLGADEISQIRSMYDPASGHLGRSVERAASEDWVMFGYYIMHNIGIAFQ
TFASGLMFGLGSAFFLFFNGLTIGAVAGHLTQIGSGGTFWSFVIGHGAFELTAIALAGAA
GLQLGWALIAPGRLSRGEALRLAAGKSVLMIGGVMLFLLIAAFIEAYWSSSAVTPATKYT
VGALLWLLVISYLSLAGRVRHAPE