Protein Info for Pf6N2E2_5491 in Pseudomonas fluorescens FW300-N2E2

Annotation: FOG: GGDEF domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 75 to 91 (17 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 200 to 360 (161 residues), 128.4 bits, see alignment E=1.1e-41 PF00990: GGDEF" amino acids 205 to 358 (154 residues), 137.2 bits, see alignment E=2.2e-44

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a4485)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZXS9 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Pf6N2E2_5491 FOG: GGDEF domain (Pseudomonas fluorescens FW300-N2E2)
LTHNAIQRLLLKRFALAAATYALALVLLWLAFFSGHYLDSLRGVIIGSVLVVLCQAGLFA
LFITDRNLRFADPSLTEAQVLIGLGWQTWMMAHLDQARGVFLVFYVLILLFGLFHLSRRA
FVRCATLVFISFAAITLWDGYFFRLPDPTLAGLQVAVLFLVLVWLVFYARYVQISRQRMR
QRRFALQAHQDTLRGMMRQLEDLVATDELTGLFNRRHFLRLASRELNTLRPGIAHGLALI
DLDHFKRINDLHGHAAGDQVLQAFAAVATACLREGDVLARYGGEEFVMLLPACDPQRLTA
CCERLRLAFTEVELIGLQVGALSLSAGMTMLGMGDDLDNALQRADQALYRAKRDGRNRCA
AAWENVDA