Protein Info for Pf6N2E2_5487 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 104.6 bits, see alignment E=8.7e-34 PF00158: Sigma54_activat" amino acids 145 to 310 (166 residues), 221 bits, see alignment E=2e-69 PF14532: Sigma54_activ_2" amino acids 145 to 315 (171 residues), 79.3 bits, see alignment E=8.7e-26 PF07728: AAA_5" amino acids 167 to 286 (120 residues), 25.7 bits, see alignment E=2.5e-09 PF02954: HTH_8" amino acids 394 to 432 (39 residues), 26.7 bits, see alignment 9.3e-10

Best Hits

Swiss-Prot: 49% identical to DCTD_RHILE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium leguminosarum

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 98% identity to pba:PSEBR_a4490)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZPK3 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Pf6N2E2_5487 Nitrogen regulation protein NR(I) (Pseudomonas fluorescens FW300-N2E2)
MLDSVMVVDDEGSIRSAVEQWLSLSGFQVQLFARADECLARLPEHFPGVILSDVRMPGLS
GLELLAEVRRRDPDLPVILLTGHGDVPMAVEAMRDGAYDFLEKPFSPEALLGSLRRALDK
RTLVLENRRLHEQADARARLDGTLLGVSRALQNLRRQVLDLAALPVNVLIRGETGSGKEL
VARCLHDFGTRASMPFVALNCAAIPEALFEAELFGHESGAFTGAQGKRIGKLEYANGGTL
FLDEIESMPLAQQVKLLRVLQEQKLERLGSNQSIQVDLRIIAATKPDLLDEARAGRFRED
LAYRLNIAELRLPPLRERREDIPLLFEHFTHSAAERLGRAAAPLSGPQLSHLLSHDWPGN
VRELANVAERQVLGLDQPQALETEPGQSLAAQQEAFEAQCLRAALTRHKGDVKAVLEELQ
LPRRTFNEKMQRHGLSREMFL