Protein Info for Pf6N2E2_5438 in Pseudomonas fluorescens FW300-N2E2

Annotation: carbonic anhydrase, family 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF14602: Hexapep_2" amino acids 70 to 102 (33 residues), 13.8 bits, see alignment 6e-06 amino acids 89 to 120 (32 residues), 19.7 bits, see alignment 8.5e-08 amino acids 107 to 121 (15 residues), 17.9 bits, see alignment (E = 3.1e-07) PF00132: Hexapep" amino acids 87 to 121 (35 residues), 38.7 bits, see alignment 7.9e-14

Best Hits

Swiss-Prot: 84% identical to Y3753_PSEAE: Uncharacterized protein PA3753 (PA3753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4536)

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A5I7 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Pf6N2E2_5438 carbonic anhydrase, family 3 (Pseudomonas fluorescens FW300-N2E2)
MKYRLGDARVETHPQSWVAPNATLVGKVRLEEGANVWFNAVLRGDNELILIGKNSNVQDG
TVMHTDMGYPLTIGTGVTIGHNAMLHGCTVGDYSLIGINAVILNGAKIGKNCIIGANSLI
GEGKEIPDGSLVMGSPGKVVRELTEAQKKMLEASAAHYVHNSQRYARDLFEQEP