Protein Info for Pf6N2E2_5371 in Pseudomonas fluorescens FW300-N2E2

Annotation: Outer membrane component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 16 to 476 (461 residues), 364 bits, see alignment E=5.9e-113 PF02321: OEP" amino acids 71 to 263 (193 residues), 62 bits, see alignment E=3.4e-21 amino acids 289 to 474 (186 residues), 75.7 bits, see alignment E=2.1e-25

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a4607)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>Pf6N2E2_5371 Outer membrane component of tripartite multidrug resistance system (Pseudomonas fluorescens FW300-N2E2)
VPRCISRELKTLSVWVLTLTISGCIGTGGIGPQSQVLPANQLATDAAIREAARDARWPTR
QWWQAYGDRQLDRWVDLAMQDSPSLAMAAARVRQAKAMAGVAEAAESLQINGEATLKRHN
WPTDQFYGPGELADTTTWDNNAALGLSYALDLWGRERNASERAVDLAHVSVAEARQAQLE
LQSNIVRAYIQFSLYYAQRDIVAATLHQQEQILDLAQKRLDGGIGTHFEVSQAQAPVPES
HRQLDALDEAIALSRNQLAALAGKGPGEGAQLHRPTLALGAPLKLPSALPAELLGQRPDV
VAGRWQVAAQARGIDVARAGFYPNVDLVGSLGYMATGGGALEFLTGKKLTYNVGPAITLP
IFDGGRLRSQLGEAAAGYDIAVAHYNQTLVNALKGISDQLIRRQSMDKQQAFAAESVAAA
QRTYDIAMVAFQRGLTDYLNVLNAQSLLFKQQQVQQQVQAARLSAHADLVTALGGGLEAG
NDSPDLSHALWQGSLLPLDCAAVPSSGCCAPKREQAPSPRC