Protein Info for Pf6N2E2_5340 in Pseudomonas fluorescens FW300-N2E2

Annotation: Stringent starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF02798: GST_N" amino acids 10 to 77 (68 residues), 54.1 bits, see alignment E=3.3e-18 PF13417: GST_N_3" amino acids 13 to 83 (71 residues), 57.3 bits, see alignment E=3.3e-19 PF13409: GST_N_2" amino acids 17 to 78 (62 residues), 61.1 bits, see alignment E=2.5e-20 PF00043: GST_C" amino acids 113 to 191 (79 residues), 29.2 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 58% identical to SSPA_SHIFL: Stringent starvation protein A (sspA) from Shigella flexneri

KEGG orthology group: K03599, RNA polymerase-associated protein (inferred from 100% identity to pba:PSEBR_a4636)

Predicted SEED Role

"Stringent starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2D8 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Pf6N2E2_5340 Stringent starvation protein A (Pseudomonas fluorescens FW300-N2E2)
MGVTNRLACYSDPADHYSHRVRIVLAEKGVSAEIIYVEAGRQPPKLIEVNPYGSLPTLVD
RDLALWESTVVMEYLDERYPHPPLLPVYPVARANSRLLIHRIQRDWCGLVDLILDSRTKE
PARVVARKELRESLTGVSPLFVDKPFFLSEEQSLVDCCLLPILWRLPILGIELPRPAKPL
LDYMERQFAREAFQASLSGVERDMR