Protein Info for Pf6N2E2_5316 in Pseudomonas fluorescens FW300-N2E2

Annotation: Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details PF02600: DsbB" amino acids 12 to 157 (146 residues), 129.2 bits, see alignment E=8.9e-42

Best Hits

Swiss-Prot: 90% identical to DSBB1_PSEPF: Disulfide bond formation protein B 1 (dsbB1) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 99% identity to pba:PSEBR_a4674)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3A2 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Pf6N2E2_5316 Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation (Pseudomonas fluorescens FW300-N2E2)
MSEEMMRLGRERRYLVLLGLICLALIGGALYMQVALGEAPCPLCILQRYALLLIAIFAFI
GAAMRTRRSLTIFEGLVVLSALAGAGVAGHHVYTQFFPAVSCGIDVLQPIVDDLPLAKIF
PLGFQVDGFCSTPYPPILGLSLAQWALVAFVLTVVLVPLLVSRNRKPLR