Protein Info for Pf6N2E2_5305 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): Fe(3+) dicitrate transport protein FecA
Rationale: Specific phenotype: utilization of Tricitrate
Original annotation: Iron(III) dicitrate transport protein FecA @ Iron siderophore receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF07660: STN" amino acids 61 to 111 (51 residues), 36.9 bits, see alignment 3.7e-13 PF07715: Plug" amino acids 137 to 250 (114 residues), 74.7 bits, see alignment E=1.2e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 138 to 779 (642 residues), 404.6 bits, see alignment E=4.4e-125 PF00593: TonB_dep_Rec_b-barrel" amino acids 330 to 746 (417 residues), 173.1 bits, see alignment E=2.9e-54

Best Hits

Swiss-Prot: 65% identical to FECA_ECOLI: Fe(3+) dicitrate transport protein FecA (fecA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 91% identity to pfo:Pfl01_0923)

MetaCyc: 65% identical to ferric citrate outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1684

Predicted SEED Role

"Iron(III) dicitrate transport protein FecA @ Iron siderophore receptor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3J8 at UniProt or InterPro

Protein Sequence (779 amino acids)

>Pf6N2E2_5305 Fe(3+) dicitrate transport protein FecA (Pseudomonas fluorescens FW300-N2E2)
MPQQPTRLTPLARTVRQWLLGASLSFVALPCVQAADAKAYHIAPSSLENALNQFGREAGV
LISFGSQTTAGLQSRGLEGSYSPEQGLSALLEGTGLQARPEGDNAFSLQPATTTALDIGT
TTVVGDWLGDAAQANVFEHPGARDVIRRETFERQGATQARDVLNRIPGVNAPENNGTGSH
DMALNFGIRGLNPRLASRSTVLMDGIPVPFAPYGQPQLSFAPVSMGNMDAVDVVRGGGAV
RYGPQNVGGVVNFVTRAIPDAPTVKGGLQTETSPSSSHDGFKTSSNLLAGGTADNGLGGA
LLYSGTRGGDWREHSDTQIDDLILKGNYQLDEANSFNAMAQYYEGEADMPGGLNVADYNA
DPYQSTRPNDRFWGRRTLVNVGYRYQQDRREFTASTFFTKTLRSGYLDQGTFLSLSPREY
WVRGLETRFAQGFDLGPTSHEVGIGYRYINEAGHELRYRTPIASNELPTTSSRNDRDTRG
GTEANAFFIDDRIDIGKWTITPGVRYEMIESQQTNNLTNVKYKGDYNTALPALNVLYHLT
DEWNLYANTEGSFGSVQYSQMPNRVSSGEVKPEKARTWELGTRYDDGNLRAEIGAFLINF
DNQYESNQTNDSVIARGETRHQGIETSINYALDVLSPALAGFDVYATYAFVDATIREDGP
NKGNRVPFSSKHKGTLGVGYTDGPWKLNLDSTYQSAQFADNANTRAESADGSTGNIPGYM
LFSSRAAYDFGPQLSDLNVAVGVKNIFNTQYFTRSFDDNNRGKYVGEPRTVYVQTSVAF