Protein Info for Pf6N2E2_5206 in Pseudomonas fluorescens FW300-N2E2

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00106: adh_short" amino acids 5 to 192 (188 residues), 158.7 bits, see alignment E=2.5e-50 PF08659: KR" amino acids 6 to 164 (159 residues), 49.1 bits, see alignment E=1.3e-16 PF13561: adh_short_C2" amino acids 13 to 243 (231 residues), 214 bits, see alignment E=4.9e-67 PF23441: SDR" amino acids 114 to 243 (130 residues), 30.1 bits, see alignment E=6.6e-11

Best Hits

Swiss-Prot: 36% identical to Y182_METEA: Uncharacterized oxidoreductase MexAM1_META1p0182 (MexAM1_META1p0182) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: None (inferred from 70% identity to rlt:Rleg2_1783)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3C7 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Pf6N2E2_5206 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Pseudomonas fluorescens FW300-N2E2)
MLTGKTALITGGNSGIGLATAKVFLAHGARVAITGRDADKLAAARRELGPGVITLVADVS
SSEQLRQMAKVVEQEFGGLDIFFANAGVAFGTPLSSTTEEQYDRLMDINVKGVFFSVQAI
EPIMRPGGSIILSTSWLNQVGAPDRTLLSASKAAVRCFARTLSAELLERRIRVNAVSPGA
IETPIHHQPNQSEEEYRAYAERVGAQAPIGRMGRAEEVAAAVLFLASDASSYMLGAEVVV
DGGRAEL