Protein Info for Pf6N2E2_5193 in Pseudomonas fluorescens FW300-N2E2

Annotation: Short chain fatty acids transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 126 to 153 (28 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 436 to 453 (18 residues), see Phobius details amino acids 463 to 488 (26 residues), see Phobius details PF02667: SCFA_trans" amino acids 34 to 478 (445 residues), 278.2 bits, see alignment E=7.1e-87

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 99% identity to pba:PSEBR_a4776)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161HA86 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Pf6N2E2_5193 Short chain fatty acids transporter (Pseudomonas fluorescens FW300-N2E2)
LRLTLEAFAAINTHNHKNEVIAVTTDIEDSRSARFALRCSSFAERWFPDSWVFAALAVLV
VAVATQFIGATPTAAAMAFGDGFWSLIPFTMQMAFVVIGGYVVASSPPAVKLIDRLARLP
TNGRSAVAWVALISMVASLLNWGLSLVFGGLLVRALARRTDLKMDYRAAGAAAYLGLGAV
WALGLSSSAAQLQANPASLPPSILSITGVIPFTQTIFLWQSGVMLLALIVISLIVAYATA
PGPNSARDAAACGIDPSFSMPALQPRTRPGEWLEHSPLLIIALVLLAAGWLFHEFSSKPA
ISAISGLNTYNFLFIMLGALLHWRPRSFLDAVARAVPTTTGVLIQFPLYGSIAALLTTVK
GSDAQTLAHHISTFFVQIASHDTYALLMGVYSAVLGFFIPSGGGKWIIEAPYVMQVANDL
NYHLGWAVQIYNAAEALPNLINPFYMLPLLGVLGLKARDLIGFSFVQLLVHTPLVLVLLW
ALGTTLSYLPPVMP