Protein Info for Pf6N2E2_5188 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 14 to 144 (131 residues), 144.7 bits, E=9.1e-47
• PF00583: Acetyltransf_1
  • amino acids 18 to 122 (105 residues), 51.8 bits, E=2.5e-17
• PF13673: Acetyltransf_10
  • amino acids 40 to 128 (89 residues), 48.2 bits, E=2.6e-16
• PF13508: Acetyltransf_7
  • amino acids 42 to 123 (82 residues), 48.4 bits, E=2.5e-16
• PF08445: FR47
  • amino acids 64 to 125 (62 residues), 33.1 bits, E=1.1e-11

Best Hits

Swiss-Prot: 43% identical to RIMI_ECO57: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Escherichia coli O157:H7

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 99% identity to pba:PSEBR_a4781)

MetaCyc: 43% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Sequence Analysis Tools

See A0A0N9X0L1 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Pf6N2E2_5188 Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-) (Pseudomonas fluorescens FW300-N2E2)
MSDAVSFRPMTEADLDAVLKIEYAAYSHPWTRGIFLDGLGKYQIWLMFEGQQQVGHGVVQ
IILDEAHLLNITVKPENQGRGLGLRLLEHLMSIAYKAEARECFLEVRDSNRTAFRLYERY
GFNEVGRRRDYYPAVGGREDAVVMACTLVD