Protein Info for Pf6N2E2_5159 in Pseudomonas fluorescens FW300-N2E2
Annotation: glutamyl-Q-tRNA synthetase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to GLUQ_PSEF5: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 99% identity to pba:PSEBR_a4810)MetaCyc: 50% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]
Predicted SEED Role
"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 6.1.1.-
Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A160A578 at UniProt or InterPro
Protein Sequence (293 amino acids)
>Pf6N2E2_5159 glutamyl-Q-tRNA synthetase (Pseudomonas fluorescens FW300-N2E2) MTAYIGRFAPTPSGHLHFGSLVAALASYLDARAMGGRWLLRMEDLDPPREEPGAQAAILK ALESYGFEWDGEMVRQSERHDAYDQVINRLFSQGLAYACTCSRKQLEAYQGIYPGLCRNA GHGTEDAAIRLRVPELEYHFTDRVQGEFRQHLGREVGDFVIRRRDGLYAYQLAVVLDDAW QGVTDIVRGADLLDSTPRQLYLQELLGLPQPRYLHVPLITQPDGHKLGKSYRSPPLAADQ ATPLLLRALRALGQQPGLELVDASPRELLAWGIRHWDAGKIPRTLSLPEAQIR