Protein Info for Pf6N2E2_5152 in Pseudomonas fluorescens FW300-N2E2

Annotation: Pantoate--beta-alanine ligase (EC 6.3.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 280 (280 residues), 353.8 bits, see alignment E=5.4e-110 PF02569: Pantoate_ligase" amino acids 3 to 278 (276 residues), 361.2 bits, see alignment E=1.5e-112 TIGR00125: cytidyltransferase-like domain" amino acids 23 to 64 (42 residues), 28.4 bits, see alignment 1.5e-10

Best Hits

Swiss-Prot: 91% identical to PANC_PSEPF: Pantothenate synthetase (panC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 98% identity to pba:PSEBR_a4817)

MetaCyc: 55% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4Z4 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Pf6N2E2_5152 Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pseudomonas fluorescens FW300-N2E2)
MNTVKTVRELRAAVARARGEGKRIAFVPTMGNLHSGHVALITKAAQRADFVVASIFVNPL
QFGAGEDLDKYPRTLAADQEKLLQAGCHLLFAPSVEEMYPDGMAGQTRVSVPQLSEGLCG
ASRPGHFEGVATVVSKLFNMVQPDLAVFGQKDFQQLAVIRALVHDLNMPIQIIGEPTVRA
EDGLALSSRNGFLSPEQRAIAPVVYRVLSQIAEAIKQGRRDFPALIDEQLKQLEAAGLRP
DYLEIRHAKTLRPALSEDRDLVILVAAFLGTTRLIDNLHLDLDTPA