Protein Info for Pf6N2E2_5139 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dephospho-CoA kinase (EC 2.7.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF01121: CoaE" amino acids 5 to 181 (177 residues), 229.8 bits, see alignment E=9.6e-73 TIGR00152: dephospho-CoA kinase" amino acids 6 to 189 (184 residues), 187 bits, see alignment E=1.5e-59

Best Hits

Swiss-Prot: 92% identical to COAE_PSEPF: Dephospho-CoA kinase (coaE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 98% identity to pba:PSEBR_a4829)

MetaCyc: 52% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A383 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Pf6N2E2_5139 Dephospho-CoA kinase (EC 2.7.1.24) (Pseudomonas fluorescens FW300-N2E2)
VKKPWILGLTGGIGSGKSAAAQHFIDLGVHVIDADHAARWVVEPGRPALAKIAEHFGPGV
LQADGALDRAALRKLIFENADERRWLEALLHPLIAEEIAHHLAQAQSPYAILVSPLLIES
GQYAMTQRILVIDAPEQLQIERTLQRDQTSEQQVQAILKAQSSRQDRLSHADDVVVNDRD
LAWLHSEVERLHHFYLTLRGGQS