Protein Info for Pf6N2E2_5125 in Pseudomonas fluorescens FW300-N2E2

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 62 to 80 (19 residues), see Phobius details PF13006: Nterm_IS4" amino acids 27 to 118 (92 residues), 97.5 bits, see alignment E=4.4e-32 PF01609: DDE_Tnp_1" amino acids 137 to 361 (225 residues), 91.9 bits, see alignment E=4.9e-30

Best Hits

Swiss-Prot: 58% identical to INSG_ECOLI: Transposase InsG for insertion sequence element IS4 (insG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 57% identity to vvy:VV3091)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A194 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Pf6N2E2_5125 Mobile element protein (Pseudomonas fluorescens FW300-N2E2)
MPVLASDFFMRLARALELTHNIASTPNAIEGLDALLDPSLVEQALEQAGVATLRKRRLPL
EMMLWCVISMAFFRRMSAWDVVSRMNIMLPGQRPLVAPSAVVQARQRLGSEAVRQVFDLT
QKSWHEAAGHPTWAGLRLLGVDGVVWRTPDTPENRARYDSASNQHGDTGFPQVRMVCQME
LTSHLLIGSAFDGYRSNEMKLAEQLIETTPDHSLTLFDRGFYSLGLLHQWQQAGVERHWL
MPLKKGSQYEVIQRLGRQDAIVSLSTSPQARKQWPGLPEQLTARLLSKTVEGKVCQILTS
MADPLRFPSDEIVDLYSQRWEIELGFREMKQTLLNSSYTLRSKTPEMIEQELWGVLLGYN
LLRYQMVEMSRHCPGIYPCEMSFTACTWAILGFINSVSADRSGNIPKYLAELHASAPHYV
LPHRREERVYPRAIRLKSPKYPIRNKNASQLN