Protein Info for Pf6N2E2_5123 in Pseudomonas fluorescens FW300-N2E2

Annotation: Two-component sensor PilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details PF25323: 6TM_PilS" amino acids 9 to 184 (176 residues), 136.9 bits, see alignment E=1.1e-43 PF00512: HisKA" amino acids 310 to 374 (65 residues), 61.4 bits, see alignment E=1e-20 PF02518: HATPase_c" amino acids 417 to 522 (106 residues), 70.2 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 60% identical to PILS_PSEAE: Sensor protein PilS (pilS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02668, two-component system, NtrC family, sensor histidine kinase PilS [EC: 2.7.13.3] (inferred from 99% identity to pba:PSEBR_a4843)

Predicted SEED Role

"Two-component sensor PilS" in subsystem Type IV pilus

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A316 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Pf6N2E2_5123 Two-component sensor PilS (Pseudomonas fluorescens FW300-N2E2)
VIAEASSPREKQAQRLLRLYHLYRLSIGITLVLLISSKLDNRLLEFANDDLLRNGSWLYL
VLNILLVVFLENIRRPARLFGLALTDVLLLSWLFFAAGGVPSAIGNLLIVSVAIGNTLLR
SRVGLLIAAVATIGIVGSTFFLGLSDSNRPSSYLQAGTLGALCFAAALLVQGLTRRLEAS
ETLAEQRASEVIGLEALNALILQRMRTGILVLDRERRVQLANESALNLLGIHDLVGQRID
DYCTALVERLQLWLNNPSLRPPSLTVTGTGLTLQPSFIALGHYDQQQLLVFLEDLAQVAQ
QAQQLKLASLGRLTAGIAHEIRNPLGAISHAAQLLRESEELNNADRRLTQIIQDHSQRMN
RVIENVLQLSRRQQTTPQRLDLRTWLDQFVRQARESMAEHQHLHLSIDPGDYTTLMDPDQ
LTQVLDNLLRNAWRHSAMAHEQAEAWLKLFIDPHSQLSTLDIIDNGPGVTPEQQAHLFEP
FFTTSSQGTGLGLYLSRELCESNQARLDFKPRQGGGCFRITFAHGRKQI