Protein Info for Pf6N2E2_508 in Pseudomonas fluorescens FW300-N2E2

Annotation: Hydrogen cyanide synthase HcnC / Opine oxidase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details PF01266: DAO" amino acids 6 to 384 (379 residues), 242.2 bits, see alignment E=4.4e-75 PF00890: FAD_binding_2" amino acids 6 to 247 (242 residues), 30.6 bits, see alignment E=7.3e-11

Best Hits

Swiss-Prot: 86% identical to HCNC_PSEPH: Hydrogen cyanide synthase subunit HcnC (hcnC) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3359)

MetaCyc: 86% identical to hydrogen cyanide synthase HcnC subunit (Pseudomonas protegens CHA0)
Glycine dehydrogenase (cyanide-forming). [EC: 1.4.99.5]

Predicted SEED Role

"Hydrogen cyanide synthase HcnC / Opine oxidase subunit B"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZT57 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Pf6N2E2_508 Hydrogen cyanide synthase HcnC / Opine oxidase subunit B (Pseudomonas fluorescens FW300-N2E2)
MIKHYDVVIAGGGVIGASCAYQLSKRKHLKVALIDAKRPGNATRASAGGLWAIGESVGLG
CGVIFFRMMSANRKRQTQGAAVAVDASTPHILPQSFFDFALQSNAMYPQLHRELIDNHGM
DFKFEQTGLKFVIYDDEDRLYAEHIVACIPHLADQVRWLDQAALREAEPNVSHEALGALE
FLCDHQVSPFRLADAYTEGARQNGVDLFFNTSVTEVLRSGTRVTGVKTAEAGTFNCQTLI
NAAGAWAADLSEQATGVRIPVKPVKGQILLTERMPKILNGCLTTSDCYVAQKDNGEILIG
STTEDKGFDVTTTYPEIEGLVQGAVRCIPQLVDINLKRTWAGLRPGSPDELPILGPMRGV
EGYLNACGHFRTGILTSAITGVLLDKLVNNEPLPLDLTPFLADRFEVAPSVVEPKDLELA