Protein Info for Pf6N2E2_5033 in Pseudomonas fluorescens FW300-N2E2

Annotation: Channel-forming transporter/cytolysins activator of TpsB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 PF08479: POTRA_2" amino acids 60 to 135 (76 residues), 90.6 bits, see alignment E=6.9e-30 PF17287: POTRA_3" amino acids 139 to 189 (51 residues), 58.7 bits, see alignment 4.9e-20 PF03865: ShlB" amino acids 194 to 511 (318 residues), 300 bits, see alignment E=3.6e-93

Best Hits

KEGG orthology group: None (inferred from 76% identity to pfl:PFL_0621)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4Y4 at UniProt or InterPro

Protein Sequence (549 amino acids)

>Pf6N2E2_5033 Channel-forming transporter/cytolysins activator of TpsB family (Pseudomonas fluorescens FW300-N2E2)
VFTSLVHAAPIQTPGDRDLIRDRQQQLLQEQQKRLDELQQLPGKTLPAPAPATPDDKRCF
DIKTIELEGAAHLDAGMREQLIKPYQNQCLSVGQINTLLKALTHHYLERGFVTTRAYLPQ
QDLSGGVLKIVVVEGRLEGFDSSALATPRELAMTFPGQTGEPLNLRELEQLVDQLSRLPS
RQAQLELAPGEQVGGSRIGLKGEREKPWRVSATRNNDGDRSTGQQQMGLGLDWDSPLGLA
DQLSLRANQDAVSDHWRHSDNQSLYYSVPYGWWTFNYAYSQSFYRASGNAQGYTFGYDGT
SKNHALRAERVLHRDNVSKTGVSFGLSQLRTRNYVDDNFIDTSSVTITETQLNLNHGRRV
GSAFINLDAGWQQGIGMLDAQRDSSHHGPQSRYNKYSLTLSYLQPFRLWGENFSFDSLAT
GQRSEDELYSPQRISLGGVSSVRGLQDQTLTGDSGGYWRNQLRWRRAVTWQPLQPLLQEY
GVAFAYDVGVIEGRSSNPDERGRLTGNALEFNARGKNLATSVSFARSLERPGIIEKRERP
VYFRVDLFF