Protein Info for Pf6N2E2_5004 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lipoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR00510: lipoyl synthase" amino acids 48 to 330 (283 residues), 433.3 bits, see alignment E=2.5e-134 PF16881: LIAS_N" amino acids 48 to 88 (41 residues), 32.1 bits, see alignment 1.4e-11 PF04055: Radical_SAM" amino acids 103 to 266 (164 residues), 76.2 bits, see alignment E=3.7e-25

Best Hits

Swiss-Prot: 98% identical to LIPA_PSEPF: Lipoyl synthase (lipA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to pba:PSEBR_a4957)

MetaCyc: 66% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4P5 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Pf6N2E2_5004 Lipoate synthase (Pseudomonas fluorescens FW300-N2E2)
MTTDAVQTIIPTQDVTERPAPRAKVEAGVKLRGAEKVARIPVKIIPTTELPKKPDWIRVR
IPVSPEVDRIKALLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGH
GRPKPLDTNEPESLAIAIADLKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLSPNVQL
ETLVPDYRGRMDIALEITAAEPPDVFNHNLETVPRLYKAARPGSDYQWSLTLLQRFKQMM
PHIPTKSGLMLGLGETDEEVIEVMKRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTFA
WFAEEGYKMGFKNVASGPLVRSSYHADEQAKLVKAELLGS