Protein Info for Pf6N2E2_5003 in Pseudomonas fluorescens FW300-N2E2
Annotation: Octanoate-[acyl-carrier-protein]-protein-N-octan oyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to LIPB_PSEPF: Octanoyltransferase (lipB) from Pseudomonas fluorescens (strain Pf0-1)
KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 99% identity to pba:PSEBR_a4958)MetaCyc: 58% identical to lipoyl(octanoyl) transferase (Escherichia coli K-12 substr. MG1655)
Lipoyl(octanoyl) transferase. [EC: 2.3.1.181]; RXN0-1138 [EC: 2.3.1.181]
Predicted SEED Role
"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism
MetaCyc Pathways
- lipoate biosynthesis and incorporation I (2/2 steps found)
- lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
- lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
- lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.181
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A160A3Z8 at UniProt or InterPro
Protein Sequence (215 amino acids)
>Pf6N2E2_5003 Octanoate-[acyl-carrier-protein]-protein-N-octan oyltransferase (Pseudomonas fluorescens FW300-N2E2) MPGTLGFRELGTMAYEPVWHAMQRFTNERGTTVDDEVWLVEHPPVFTQGQAGKAEHLLLP GDIPVVKVDRGGQVTYHGPGQLVAYLLLDVRKLGFGVRELVTRMETCLIELLASYGVTAA AKPDAPGVYVDGAKIASLGLRIRHGCSFHGLALNVDMDLEPFRRINPCGYAGLAMTQLSE HAGSIEFAEVSARLRAQLVKHLDYAEQTTLTGGID