Protein Info for Pf6N2E2_4998 in Pseudomonas fluorescens FW300-N2E2

Annotation: Rod shape-determining protein RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 278 to 305 (28 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 28 to 376 (349 residues), 439.7 bits, see alignment E=4.2e-136 PF01098: FTSW_RODA_SPOVE" amino acids 35 to 376 (342 residues), 369.7 bits, see alignment E=7.3e-115

Best Hits

Swiss-Prot: 53% identical to RODA_SHIFL: Peptidoglycan glycosyltransferase MrdB (mrdB) from Shigella flexneri

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 98% identity to pba:PSEBR_a4963)

MetaCyc: 53% identical to peptidoglycan glycosyltransferase MrdB (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZXI4 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Pf6N2E2_4998 Rod shape-determining protein RodA (Pseudomonas fluorescens FW300-N2E2)
VKNNFDRILSSEDVMRRRATLLQRMHIDGPLLILLLTLAAGSLFVLYSASGKNWDLLGKQ
ATSFGIGLVSMVVIAQLEPRFMARWVPLAYVVGVSLLVVVDVMGHNAMGATRWINIPGVI
RFQPSEFLKIIMPATIAWYLAKRTLPPQLKHVCISLLLIGIPFILIVRQPDLGTSLLILA
GGAFVLFMGGLRWRWILSVVAIAVPVSVAMWYFVMHDYQKQRILTFLDPESDPLGTGWNI
IQSKAAIGSGGVFGKGWLMGTQSHLDFLPESHTDFIIAVLGEEFGLVGICVLLLIYLLLI
GRGLVITAQAQTLFGKLLAGSLTMTFFVYVFVNIGMVSGLLPVVGVPLPFISYGGTSLVT
LLSAFGVLMSIHTHRKWIAQV