Protein Info for Pf6N2E2_4953 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative lipase in cluster with Phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 PF12146: Hydrolase_4" amino acids 31 to 267 (237 residues), 245.9 bits, see alignment E=7.3e-77 PF00561: Abhydrolase_1" amino acids 36 to 154 (119 residues), 45.2 bits, see alignment E=1.9e-15 PF12697: Abhydrolase_6" amino acids 49 to 240 (192 residues), 36.4 bits, see alignment E=1.8e-12 PF12147: Methyltransf_20" amino acids 276 to 583 (308 residues), 511.5 bits, see alignment E=1.5e-157

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5008)

Predicted SEED Role

"Putative lipase in cluster with Phosphatidate cytidylyltransferase" in subsystem Triacylglycerol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2N6 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Pf6N2E2_4953 Putative lipase in cluster with Phosphatidate cytidylyltransferase (Pseudomonas fluorescens FW300-N2E2)
MREAQELTFTTHDGVELFYRHWPAVDAAAGDPRQAVLLFHRGHEHSGRIAHLVDELDLPG
FDFFAWDARGHGQSPGERGDSPSFATSARDVQTFCDHIGATHQIDEANIAVVAQSVGAVI
ASTWVHDYAPRIRSLVLASPAFKVKLYVPFARPGLALMRKFRGNFFVNSYVKAKFLSHDP
ERVASYDSDPLITKAISVNVLLGLYEAADRVVADAQAIQVPTQLLISGSDFVVHRKPQEQ
FFERLGSLHKEKHILPGFFHDTLGEKNRAPAIASARRFILQNFARALDRPSLLDADRLGA
TCAEAETLATPLPHNSLRDLYWRMTRASMRFGSKLSAGVKLGFDTGFDSGSTLDYVYRNR
PTGTSALGKMIDQNYLNSIGWRGIRQRKLHVEELLRLAMGELRAQDREVRIVDIAAGHGR
YILEALQGVSPLPESILLRDYSDINVRDGSALIVEKGLGDIARFVKGDAFDRQDLAALEP
KPTLAVVSGLYELFADNQLVGGSLAGLAEAVEPGGFLVYTGQPWHPQLELIARALTSHRA
GQAWVMRRRTQAEMDQLVEAAGFRKITLRVDEWGIFSVSLAQRVQ