Protein Info for Pf6N2E2_4900 in Pseudomonas fluorescens FW300-N2E2

Annotation: Inner membrane protein YbhQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 252 to 283 (32 residues), see Phobius details amino acids 294 to 319 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 36 to 311 (276 residues), 48.8 bits, see alignment E=3.6e-17

Best Hits

Swiss-Prot: 48% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 98% identity to pba:PSEBR_a5058)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H3S8 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Pf6N2E2_4900 Inner membrane protein YbhQ (Pseudomonas fluorescens FW300-N2E2)
MNHSEAHAAPRDAHAPEQSKPKSRWSRWKRPLTLAFFLLLIVLFTTLARRIDWSEVFATL
ADFKVRTLIIAAALTVTSFITYACFDLIGRTYIRQKLGWRQILPVGVISYAFNLNLSAWV
GGIAMRYRLYSRLGVSTGNIAKILGLSLATNWFGYMTLAGVVFSSGLVTMPPGWKLSSDA
LQGVGALLLLVSAGYLVACRFSKRRAWTIRGMEINLPSPRMAVLQLALGALNWSLMAAVI
FTLLPGKLDYPVVLGVLLISSIAGVITHIPAGLGVLEAVFVALLQHEVSRGSLLAGLIAY
RAIYFILPLLITVVMYLVIEAKAKALRVKPGVK