Protein Info for Pf6N2E2_4819 in Pseudomonas fluorescens FW300-N2E2

Annotation: Alcohol dehydrogenase (EC 1.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 244 to 264 (21 residues), see Phobius details amino acids 273 to 289 (17 residues), see Phobius details PF00465: Fe-ADH" amino acids 10 to 175 (166 residues), 155.2 bits, see alignment E=1.9e-49 PF13685: Fe-ADH_2" amino acids 15 to 108 (94 residues), 30.3 bits, see alignment E=5.9e-11 PF25137: ADH_Fe_C" amino acids 186 to 382 (197 residues), 214.2 bits, see alignment E=2.2e-67

Best Hits

Swiss-Prot: 48% identical to ADH1_GEOTN: Long-chain-alcohol dehydrogenase 1 (adh1) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a5124)

MetaCyc: 38% identical to alcohol dehydrogenase II monomer (Zymomonas mobilis)
Alcohol dehydrogenase. [EC: 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0M3 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Pf6N2E2_4819 Alcohol dehydrogenase (EC 1.1.1.1) (Pseudomonas fluorescens FW300-N2E2)
MSLSSFKIAHKLITGAAAIEQLAAELTRLDVDNPLIVTDAALVKSGTVELALQHLGGRDY
EIFDRVMPDPEIAIVEDCMQAYRDGGHDGLIGLGGGSAIDIAKCVGVYAGYHGELQDMFG
VDQVPRKGPPMIAIPTTAGTGSEVTNVAILSDKAAQLKKGIVSDYLLPDVALVSPQMTLT
CPRGVTAASGVDALAHAIEAYLSLNASPITDALAIGAIKLISRALPKAYANPAHLQARED
MATASLMAGMAFGNAGVGAVHALAYPLGGRFHVSHGVANAMLLPYVMTWNKMACVERMRD
IAEAMGLKTAHLSDLEAADEAVEAMITLCAAVEIPQGLSSLGVTEDVIPSMAVEAAGIER
LMRNNPRKLSAADIEKIYRAAY