Protein Info for Pf6N2E2_4790 in Pseudomonas fluorescens FW300-N2E2

Annotation: sensory box/GGDEF domain/EAL domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1247 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 267 to 288 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 38 to 255 (218 residues), 88.9 bits, see alignment E=9.7e-29 TIGR00229: PAS domain S-box protein" amino acids 307 to 432 (126 residues), 41.2 bits, see alignment E=1.6e-14 amino acids 435 to 556 (122 residues), 49.1 bits, see alignment E=5.9e-17 amino acids 558 to 681 (124 residues), 47.3 bits, see alignment E=2.2e-16 amino acids 686 to 803 (118 residues), 68 bits, see alignment E=8.6e-23 PF08447: PAS_3" amino acids 336 to 415 (80 residues), 37.2 bits, see alignment 1.2e-12 amino acids 706 to 789 (84 residues), 28.9 bits, see alignment 4.5e-10 PF13188: PAS_8" amino acids 438 to 478 (41 residues), 15 bits, see alignment (E = 7.7e-06) amino acids 561 to 604 (44 residues), 19 bits, see alignment (E = 4.3e-07) amino acids 685 to 725 (41 residues), 27.5 bits, see alignment (E = 8.7e-10) PF13426: PAS_9" amino acids 449 to 548 (100 residues), 27.3 bits, see alignment E=1.4e-09 amino acids 571 to 673 (103 residues), 29.1 bits, see alignment E=4e-10 amino acids 693 to 794 (102 residues), 53.4 bits, see alignment E=1.1e-17 PF00989: PAS" amino acids 686 to 793 (108 residues), 44.5 bits, see alignment E=5.7e-15 PF08448: PAS_4" amino acids 688 to 796 (109 residues), 31.7 bits, see alignment E=6.5e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 803 to 966 (164 residues), 140.6 bits, see alignment E=4e-45 PF00990: GGDEF" amino acids 807 to 964 (158 residues), 169.3 bits, see alignment E=2.4e-53 PF00563: EAL" amino acids 985 to 1219 (235 residues), 246 bits, see alignment E=1.4e-76

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5152)

Predicted SEED Role

"sensory box/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4G9 at UniProt or InterPro

Protein Sequence (1247 amino acids)

>Pf6N2E2_4790 sensory box/GGDEF domain/EAL domain protein (Pseudomonas fluorescens FW300-N2E2)
MPRLTAALLLSLMTWTATAGALTLTDEELRWLKDHPDLRLGVDASWPPFEFRDDQGRYQG
LAADYVDIIRERLAIKLTPIEPVSWTAVLEQVAQGKIDLLPGIMSTPERQNYLAFTRPYL
DFPIVILAHRGGAQPYNLKELYGLKIAVVENYAPHELLRNHHPDLNLVALPNVSSALQAL
ATDEVDAVVGDLASSVWSLRQLKLEGLYVSGETPYRYQLAMAVPRDNKILVGILDKVMAD
MSPAEVAEIQQKWVGNVHDYRQLWSDLLLYGLPALLLLIGILAVVIRINRRLSSEIARRV
ELEQELRSSEYHYRGLVESLSAIAWEARVSDFTYSYVSPHAEDLLGYPLSHWLIPGFWRN
IIHPADLIRAQTYCDHEVLAGRDHCIDYRVITADGRCLWVRDIVSLIEHGHEPVMRGLMI
DISEAKRTEEALRLSEQKFASVFRQCPDILVIARLLDGCLLEVNKAFEEQIGLSAAEVVG
HSATELNIWGIQGVGPGLLQRLQAGSIRNLEMPFRRSNGQVFTGLISAEPFDLDTTPALV
VVVRDISQLKETQQQLQTSEEKFAKAFHASPDGLLLSRQSDGLLIEVNEGFSRITGFNSA
LSVDRSTLDLGIWVNLNERKQMLDLLKRDGFVRDFSCHIRRNDGQIRLCEVSSRPLPIGN
EDCMLTIARDITERHLMQEKLQQAATVFESTAEGVLITDTQQHISAVNRAFTEITGYSET
EALGHTPRLLASGLHDSAFYAAMWHQLTAEGHWQGEISNRRKNGELYPSWLTISAVRNRD
RQITHFVAVFADISSLKHAQARLDYQAHHDPLTGLPNRTLFESRLLAALNGQQENGSQGA
VLFLDLDRFKHINDSLGHPVGDLLLKGIAVRLREQLRDIDTVARLGGDEFIILLPGLQQP
SDAEHIAQKLLNCFAAPFQAGEHEFFISASIGTSLYPQDGCDVATLVKNADAAMYRSKAK
GRNRVESYTRDLTAQASERVALEHELRRAIERNELSLSFQPKISLVDNQLVGAEALIRWT
HPTFGDVPPEHFIPLAEENGMILQIGDWVLERACRQLCEWNDAYDSLGPLSVNLAGAQLR
QPNLLGRIEQLLREHQLEPGLLQLEITENFIMSQAEEALTVLHQLKKLGVQLAIDDFGTG
YSSLSYLKRLPLDILKIDQSFVRGLPDDPHDAAIVRAIIALGRSMQFTIIAEGVETLAQQ
QFLTEEGCEQIQGYIVSLPLCADEFAATFLRVAVSDFSDSTAEKPSL