Protein Info for Pf6N2E2_4737 in Pseudomonas fluorescens FW300-N2E2

Annotation: Two-component response regulator CreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00072: Response_reg" amino acids 36 to 144 (109 residues), 90.8 bits, see alignment E=6.7e-30 PF00486: Trans_reg_C" amino acids 177 to 252 (76 residues), 72 bits, see alignment E=3.4e-24

Best Hits

Swiss-Prot: 43% identical to REGX3_MYCS2: Sensory transduction protein regX3 (regX3) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K07663, two-component system, OmpR family, catabolic regulation response regulator CreB (inferred from 98% identity to pba:PSEBR_a5202)

Predicted SEED Role

"Two-component response regulator CreB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H3Q7 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Pf6N2E2_4737 Two-component response regulator CreB (Pseudomonas fluorescens FW300-N2E2)
VQQRPTHKLNCQLTCPKPCGTVPATLLPGSQAMPHILIVEDEAAIADTLVFALQGEGFDT
TWLSLGAAALDHQKNTPADLIILDVGLPDISGFETCKNLRRFSDVPVIFLTARDGEIDRV
VGLEIGADDYVVKPFSPREVAARVRAILKRVAPRPAADSSTALFQVDSDRVQINYRGKPL
NLTRHEFRLLNCLLEQPERVFSREQLLDALGVASDAGYERSIDSHIKSVRAKLRLVRAEA
EPIQTHRGLGYSYSPGHS