Protein Info for Pf6N2E2_4674 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details amino acids 435 to 458 (24 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 18 to 417 (400 residues), 254 bits, see alignment E=1.4e-79 PF07690: MFS_1" amino acids 19 to 410 (392 residues), 144.8 bits, see alignment E=3.2e-46 amino acids 273 to 456 (184 residues), 37 bits, see alignment E=2e-13 PF00083: Sugar_tr" amino acids 44 to 115 (72 residues), 28 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 50% identical to MDTD_PECCP: Putative multidrug resistance protein MdtD (mdtD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a5251)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0E2 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Pf6N2E2_4674 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N2E2)
MPNRAPLDAVTARWLPWVVAIAFFMQSLDGTILNTALPAMASDLAENPLRMQGVIIAYML
TVALLIPASGWIADRFGTKKIFFGAILLFSFGSLLCALSNSLSMLIGARVIQGLGGALML
PVGRLVVLRAYPRSELVRIMGFITIPGLLGPLIGPTMGGWMVEYLTWHWIFIINLPVGVI
GCYAVWKFIPDLRGSERTRFDGLGFLLFGAAMVLITIAMEGLGELHLPHLRVMLLLFGGM
ACLAAYWLRAGHVENALFPPSLFKTRTFAVGILGNLFARLGSGALPFLVPLLLQVALGYS
PSQAGMSMLPLAAAAMVAKSVARPLIERLGYRIVLTGNTLALGLMLASMGLVSEQTPYWL
LLAQLAVLGAINSLQFTAMNTVTLIDLDDASASSGNSLLSVVAQLSLSLGVACAGALLGG
FTAQAGNDGVDTVLGAFQLTFVTVGIMAMLAATIFSQLSKQDGRRQKRHDEHIEH