Protein Info for Pf6N2E2_4644 in Pseudomonas fluorescens FW300-N2E2

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 340 (333 residues), 149.6 bits, see alignment E=5.5e-48

Best Hits

Swiss-Prot: 46% identical to YDHP_ECOLI: Inner membrane transport protein YdhP (ydhP) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 97% identity to pba:PSEBR_a5280)

Predicted SEED Role

"Arabinose efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A495 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Pf6N2E2_4644 Arabinose efflux permease (Pseudomonas fluorescens FW300-N2E2)
MPLALLALAVAAFGIGTTEFVIMGLLPDVARDLAVSIPQAGLLITGYALGVVFGAPILAI
GTANMPRKATLLGMTLMFILGNVLCALAPNYATLMAARVITALCHGAFFGIGSVVAAGLV
APNKRAQAIAMMFTGLTLANVLGVPLGTALGQYAGWRSTFWAVSVIGVIAAIAQWVWLPK
DIPMDKANLASEFKVLGKANVLLALGMSVLASTSLFSVFTYIAPILQDITGVSPHGITVM
LLLFGVGLTAGSFLGGRLADRRLLPSLVGMALAVVLVLAAFSQTSQSVIPAAITLVLWGI
FAFALCPILQLLIIDQAFEAPNLGSTLNQSAFNLGNAAGAWIGGLVVASGADLADLPWTG
AAVGGLTVLTALFFIHRQRRLAAVAV